PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 289aa    MW: 32360.1 Da    PI: 8.9661
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767955.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-383898262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +++ lkcprC+s+ntkfCyynnyslsqPr+fCk+C+ryWt+GG++rnvPvGgg+rknkk +
  XP_009767955.1 38 QQQPLKCPRCNSSNTKFCYYNNYSLSQPRHFCKGCKRYWTRGGTIRNVPVGGGCRKNKKIK 98
                    57899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-273696IPR003851Zinc finger, Dof-type
PfamPF027015.2E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1614296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MLVIDSEKMA QISSTTNEIW PQQNNESRYM EKSISQDQQQ PLKCPRCNSS NTKFCYYNNY  60
SLSQPRHFCK GCKRYWTRGG TIRNVPVGGG CRKNKKIKKP NATTTNLSHN FHQPQIIDDL  120
SPITSTHHSN PLFYGLPTNP SDLNTQFPRL FNFRVSNTDQ NLGLGFSSGQ IQDVMTTTNS  180
ISHISSYPIF GSSLISSSNS NLASLIASSL QQQNFKSNNN KFQDLSPYTG EGGNVMLKEV  240
KMEGESQKRL DWNISNNQIQ QINSADPSLT WAGTYVDPSN IESSVPALI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX0228911e-48JX022891.1 UNVERIFIED: Solanum lycopersicoides voucher UCD:TGRC LA2408 putative Dof zinc finger protein-like (Dof01) gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767955.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0B0M5Z52e-78A0A0B0M5Z5_G
STRINGVIT_10s0003g00040.t015e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-37Dof family protein